YDR226W
Systematic NameYDR226W
Standard NameADK1
SynonymAKY1
AKY2
Full Nameadenylate kinase
DescriptionAdenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005737 cytoplasm
GO:0005758 mitochondrial intermembrane space
Molecular FunctionGO:0004017 adenylate kinase activity
Biological ProcessGO:0006172 ADP biosynthesis
GO:0009117 nucleotide metabolism
Localizationgranular staining * granular staining
Sequence
MSSSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQ
LGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQA
EKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNP
PKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWA
GVDASQPPATVWADILNKLGKD
Length222
Image
 
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000002634
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.