YCL025C
Systematic NameYCL025C
Standard NameAGP1
SynonymYCC5
Full Nameamino acid permease
DescriptionLow-affinity amino acid permease with broad substrate range, involved in uptake of asparagine, glutamine, and other amino acids; expression is regulated by the SPS plasma membrane amino acid sensor system (Ssy1p-Ptr3p-Ssy5p)
CommentNull mutant is viable; resistant to the amino acid analog gamma-hydroxyaspartate, decreased growth on asn, gln and some other amino acids in strains in which Gap1 and Gnp1 are also missing.
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005886 plasma membrane
Molecular FunctionGO:0005296 L-proline permease activity
GO:0015171 amino acid transporter activity
Biological ProcessGO:0006865 amino acid transport
LocalizationGranular staining
Sequence
MSSSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQ
HNTSAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNE
SSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAG
PAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGF
AVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINI
FGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDP
GAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA
KQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHG
VRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRA
GRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLS
HLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAP
IGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHR
QIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC
Length633
MSSSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQ
HNTSAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNE
SSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAG
PAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGF
AVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINI
FGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDP
GAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA
KQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHG
VRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRA
GRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLS
HLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAP
IGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHR
QIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC
Length633
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000530


Kumar Lab
MCDB
The University of Michigan.