YHR018C
Systematic NameYHR018C
Standard NameARG4
Full Nameargininosuccinate lyase
DescriptionArgininosuccinate lyase, catalyzes the final step in the arginine biosynthesis pathway
CommentArginine requiring
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005829 cytosol
Molecular FunctionGO:0004056 argininosuccinate lyase activity
Biological ProcessGO:0006526 arginine biosynthesis
Localizationgranular staining
Sequence
MSDGTQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTAGLQ
KLGLLTETELAKIHEGLAEIKKEWDADKFVRHPNDEDIHTANERRLGELI
GRDIAGKVHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKGLVEVLIKRAE
GEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP
LGAGALAGHPYGIDREFLAEGLGFNSVIGNSLVAVSDRDFIVELMFWGTL
FMNHISRFAEDLIIYCTAEFGFIQLSDAYSTGSSLMPQKKNADSLELLRG
KSGRVFGDLTGFLMSLKGIPSTYDKDMQEDKEPLFDCLTTVEHSMLIATG
VISTLTVNKEKMEAALTMDMLATDLADYLVRKGVPFRETHHISGECVATA
ERLGLSGIDKLTLEQYQKIDSRFGQDLFETFNFEQSVERRDATGGTAKSA
VLKQLDNLKSQLN
Length463
Image
 
Data Source
 SGD:S000001060
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.