YJR089W
Systematic NameYJR089W
Standard NameBIR1
DescriptionEssential chromosomal passenger protein involved in coordinating cell cycle events for proper chromosome segregation; C-terminal region binds Sli15p, and the middle region, upon phosphorylation, localizes Cbf2p to the spindle at anaphase
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0000778 condensed nuclear chromosome kinetochore
GO:0005739 mitochondrion
GO:0005819 spindle
GO:0051233 spindle midzone
Molecular FunctionGO:0005554 molecular function unknown
Biological ProcessGO:0000022 mitotic spindle elongation
GO:0007059 chromosome segregation
Sequence
MDGQIDKMEKRYSMTKLENRLRTFQDGVALEKKKLKWSFKVIPYQAMAKL
GFYFDPVIDPKTSKLKKDSVRCCYCHRQTYNVRDCRSKRKDVLETLSNIM
RQHLTVTDNKQVCLLIYLRNKLLTDYSFHMGVSDWKNDKYFSNPDDENVI
NLRKFTFQDNWPHSGSQNEHPLGIEKMVNAGLMRYDSSIEGLGDPSMDKT
LMNDTCYCIYCKQLLQGWSINDDPMSRHYKVSQNGNCYFFQTRNRFERIK
NDNDSITKNCEVSPTLGENGKREVINTKTASQRQCPLFESPPSSTGPQLD
DYNEKTDISVIQHNISVLDGAQGENVKRNSVEEKEQINMENGSTTLEEGN
INRDVLADKKEVISTPTAKEIKRPNVQLTQSSSPIKKKRKFKRISPRKIF
DEEDSEHSLNNNSANGDNKDKDLVIDFTSHIIKNRDVGRKNAILDDSTDE
FSFSNQGHNTFDIPIPTSSHLLKGIDSDNDNVIREDDTGINTDTKGASSK
HEKFSVNSEEDLNFSEVKLTGRDSSTNILIRTQIVDQNLGDIDRDKVPNG
GSPEVPKTHELIRDNSEKREAQNGEFRHQKDSTVRQSPDILHSNKSGDNS
SNITAIPKEEQRRGNSKTSSIPADIHPKPRKNLQEPRSLSISGKVVPTER
KLDNINIDLNFSASDFSPSSQSEQSSKSSSVISTPVASPKINLTRSLHAV
KELSGLKKETDDGKYFTNKQETIKILEDVSVKNETPNNEMLLFETGTPIA
SQENKSRKLFDEEFSGKELDIPIDSSTVEIKKVIKPEFEPVPSVARNLVS
GTSSYPRNSRLEEQRKETSTSLADNSKKGSSFNEGNNEKEPNAAEWFKID
ENRHLVKNYFHDLLKYINNNDATLANDKDGDLAFLIKQMPAEELDMTFNN
WVNLKVQSIKREFIDDCDKKLDILRRDYYTATNFIETLEDDNQLIDIAKK
MGIL
Length954
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000003849
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.