YCR005C
Systematic NameYCR005C
Standard NameCIT2
Full Namecitrate synthase
DescriptionCitrate synthase, catalyzes the condensation of acetyl coenzyme A and oxaloacetate to form citrate, peroxisomal isozyme involved in glyoxylate cycle; expression is controlled by Rtg1p and Rtg2p transcription factors
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005739 mitochondrion
Molecular FunctionGO:0004108 citrate (Si)-synthase activity
Biological ProcessGO:0006097 glyoxylate cycle
GO:0006101 citrate metabolism
GO:0006537 glutamate biosynthesis
Sequence
MTVPYLNSNRNVASYLQSNSSQEKTLKERFSEIYPIHAQDVRQFVKEHGK
TKISDVLLEQVYGGMRGIPGSVWEGSVLDPEDGIRFRGRTIADIQKDLPK
AKGSSQPLPEALFWLLLTGEVPTQAQVENLSADLMSRSELPSHVVQLLDN
LPKDLHPMAQFSIAVTALESESKFAKAYAQGISKQDYWSYTFEDSLDLLG
KLPVIAAKIYRNVFKDGKMGEVDPNADYAKNLVNLIGSKDEDFVDLMRLY
LTIHSDHEGGNVSAHTSHLVGSALSSPYLSLASGLNGLAGPLHGRANQEV
LEWLFALKEEVNDDYSKDTIEKYLWDTLNSGRVIPGYGHAVLRKTDPRYM
AQRKFAMDHFPDYELFKLVSSIYEVAPGVLTEHGKTKNPWPNVDAHSGVL
LQYYGLKESSFYTVLFGVSRAFGILAQLITDRAIGASIERPKSYSTEKYK
ELVKNIESKL
Length460
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000598
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.