YGR255C
Systematic NameYGR255C
Standard NameCOQ6
Full Namemonooxygenase
DescriptionPutative flavin-dependent monooxygenase, involved in ubiquinone (Coenzyme Q) biosynthesis; located on the matrix side of the mitochondrial inner membrane
CommentUnable to produce ubiquinone, hypersensitivity to polyunsaturated fatty acid treatment
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
Molecular FunctionGO:0015997 ubiquinone biosynthesis monooxygenase activity
Biological ProcessGO:0006743 ubiquinone metabolism
LocalizationGranular staining
Sequence
MFFSKVMLTRRILVRGLATAKSSAPKLTDVLIVGGGPAGLTLAASIKNSP
QLKDLKTTLVDMVDLKDKLSDFYNSPPDYFTNRIVSVTPRSIHFLENNAG
ATLMHDRIQSYDGLYVTDGCSKATLDLARDSMLCMIEIINIQASLYNRIS
QYDSKKDSIDIIDNTKVVNIKHSDPNDPLSWPLVTLSNGEVYKTRLLVGA
DGFNSPTRRFSQIPSRGWMYNAYGVVASMKLEYPPFKLRGWQRFLPTGPI
AHLPMPENNATLVWSSSERLSRLLLSLPPESFTALINAAFVLEDADMNYY
YRTLEDGSMDTDKLIEDIKFRTEEIYATLKDESDIDEIYPPRVVSIIDKT
RARFPLKLTHADRYCTDRVALVGDAAHTTHPLAGQGLNMGQTDVHGLVYA
LEKAMERGLDIGSSLSLEPFWAERYPSNNVLLGMADKLFKLYHTNFPPVV
ALRTFGLNLTNKIGPVKNMIIDTLGGNEK
Length479
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000003487
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.