YAL013W
Systematic NameYAL013W
Standard NameDEP1
SynonymFUN54
DescriptionTranscriptional modulator involved in regulation of structural phospholipid biosynthesis genes and metabolically unrelated genes, as well as maintenance of telomeres, mating efficiency, and sporulation
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
Molecular FunctionGO:0030528 transcription regulator activity
Biological ProcessGO:0000723 telomere maintenance
GO:0006357 regulation of transcription from RNA polymerase II promoter
GO:0006644 phospholipid metabolism
Sequence
MSQQTPQESEQTTAKEQDLDQESVLSNIDFNTDLNHNLNLSEYCISSDAG
TEKMDSDEEKSLANLPELKYAPKLSSLVKQETLTESLKRPHEDEKEAIDE
AKKMKVPGENEDESKEEEKSQELEEAIDSKEKSTDARDEQGDEGDNEEEN
NEEDNENENEHTAPPALVMPSPIEMEEQRMTALKEITDIEYKFAQLRQKL
YDNQLVRLQTELQMCLEGSHPELQVYYSKIAAIRDYKLHRAYQRQKYELS
CINTETIATRTFIHQDFHKKVTDLRARLLNRTTQTWYDINKERRDMDIVI
PDVNYHVPIKLDNKTLSCITGYASAAQLCYPGEPVAEDLACESIEYRYRA
NPVDKLEVIVDRMRLNNEISDLEGLRKYFHSFPGAPELNPLRDSEINDDF
HQWAQCDRHTGPHTTSFCYS
Length420
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000011
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.