YDR021W
Systematic NameYDR021W
Standard NameFAL1
Full NameRNA helicase (putative), dead box protein
DescriptionNucleolar protein required for maturation of 18S rRNA, member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases
CommentNull mutant is inviable; when Fal1p is depleted, either in a temperature-sensitive fal1-1 mutant or in glucose medium when Fal1p is under a gal promoter, there is a decrease in 40S ribosomal subunits, and those strains are sensitive to paromomycin and neomycin
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005730 nucleolus
Molecular FunctionGO:0004004 ATP-dependent RNA helicase activity
Biological ProcessGO:0006365 35S primary transcript processing
Sequence
MSFDREEDQKLKFKTSKKLKVSSTFESMNLKDDLLRGIYSYGFEAPSSIQ
SRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPT
RELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTP
GRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNC
QVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEE
WKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMK
QEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYI
HRIGRSGRFGRKGVAINFITKADLAKLREIEKFYSIKINPMPANFAELS
Length399
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000002428
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.