YKR039W
Systematic NameYKR039W
Standard NameGAP1
Full Namegeneral amino acid permease
DescriptionGeneral amino acid permease; localization to the plasma membrane is regulated by nitrogen source
Commentabolished activity of the general amino acid transport system
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0000328 vacuolar lumen (sensu Fungi)
GO:0005768 endosome
GO:0005771 multivesicular body
GO:0005886 plasma membrane
GO:0005887 integral to plasma membrane
GO:0030134 ER to Golgi transport vesicle
Molecular FunctionGO:0005296 L-proline permease activity
GO:0015203 polyamine transporter activity
GO:0015359 amino acid permease activity
Biological ProcessGO:0006865 amino acid transport
GO:0015846 polyamine transport
Sequence
MSNTSSYEKNNPDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDETGSGS
KWQDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAI
GGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP
ISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTD
PKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGII
LNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSE
LVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLI
GASSVDAAASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRT
MVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFN
WLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSY
WGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIY
KRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNF
WC
Length602
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000001747
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.