YMR311C
Systematic NameYMR311C
Standard NameGLC8
Full Nameprotein phosphatase 1 (Glc7p) regulator
DescriptionRegulatory subunit of protein phosphatase 1 (Glc7p), involved in glycogen metabolism and chromosome segregation; proposed to regulate Glc7p activity via conformational alteration; ortholog of the mammalian protein phosphatase inhibitor 2
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
GO:0005737 cytoplasm
Molecular FunctionGO:0008047 enzyme activator activity
Biological ProcessGO:0005978 glycogen biosynthesis
GO:0007059 chromosome segregation
Localizationgranular staining * granular staining; * granular staining; concentrated staining at the nuclear rim
Sequence
MGGILKNPLALSPEQLAQQDPETLEEFRRQVYENTQKNAKLTSHKRNIPG
LDNTKEEGEIIGTSSTFLPKDTLSLKHEQDMLAKMTPEERVQWNQRNLAE
NEITKKQFQDIHIDEPKTPYQGAVDPHGEYYRVDDDEDEDNSDKKPCQVA
NDDIDDLSLGEPEFEIKENKQPDFETNDENDEDSPEARHKKFEEMRKKHY
DVRAIFNKKSREALKDEDEDEDDSTTKEP
Length229
Image
 
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000004928
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.