YPR133C
Systematic NameYPR133C
Standard NameIWS1
SynonymSPN1
Full Nameinvolved in transcriptional elongation
DescriptionProtein that interacts with Spt6p and copurifies with Spt5p and RNA polymerase II, probable transcriptional elongation factor; metazoan homologs contain an acidic N terminus; mutations in the gene confer an Spt- phenotype
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0008023 transcription elongation factor complex
Molecular FunctionGO:0016944 RNA polymerase II transcription elongation factor activity
Biological ProcessGO:0006368 RNA elongation from RNA polymerase II promoter
Sequence
MSTADQEQPKVVEATPEDGTASSQKSTINAENENTKQNQSMEPQETSKGT
SNDTKDPDNGEKNEEAAIDENSNVEAAERKRKHISTDFSDDDLEKEEHND
QSLQPTVENRASKDRDSSATPSSRQELEEKLDRILKKPKVRRTRRDEDDL
EQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVV
SVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLP
VKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPIIGASDNY
RDKRIMQLEFDSEKLRKKSVMDSAKNRKKKSKSGEDPTSRGSSVQTLYEQ
AAARRNRAAAPAQTTTDYKYAPVSNLSAVPTNARAVGVGSTLNNSEMYKR
LTSRLNKKHK
Length410
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000006337
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.