YJL162C
Systematic NameYJL162C
Standard NameJJJ2
DescriptionProtein of unknown function, contains a J-domain, which is a region with homology to the E. coli DnaJ protein
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
GO:0005737 cytoplasm
Molecular FunctionGO:0005554 molecular function unknown
Biological ProcessGO:0000004 biological process unknown
Localizationgranular staining
Sequence
MSQVIEPQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKS
EELFKAVVHAHSILTDEDQKLRYDRDLKIKGLHTYQPKKNCHIFKTKAKE
SQGASPTLGQSEAYHRQNKPYEQQPYGFGVGKKMTSSSKSKVPIFKSFNL
KSYQRNHYYSSKKERKHGSPDIDSLFHETNGASKVRMTDAGKMDTNSQFQ
EIWEILGKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQQQQQQQQQQQ
QQHYGMTSKSSSPDEEKKNNKEPKRESRVSPEENGEEETGHKQFKLPKTS
TFSSGSHDSNLQSPFYNHEYRHYARSKFECKNQFRKSVSPIKEIPATTSA
NEGWNILRDIIEKLNISNVDDRNKDLLFRRDEIGDKNHSDSIDIENLSIK
EPKGMKRRKKDDISLEELFQSLPREKDYFMMDAINDSLESINLFKKPKTT
QSHEQGGTFAQAESNRAKFKPLLEQCGITPEILDLEIPEIPEFDAVADLE
TLKLNVQLFNNQCNKLKETIHQVSLQRLRADTQFSDMLTQKQSIMVWKTY
LEFDKSLMDKLNILQERQMQVIKIFSERCDGKV
Length583
MSQVIEPQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKS
EELFKAVVHAHSILTDEDQKLRYDRDLKIKGLHTYQPKKNCHIFKTKAKE
SQGASPTLGQSEAYHRQNKPYEQQPYGFGVGKKMTSSSKSKVPIFKSFNL
KSYQRNHYYSSKKERKHGSPDIDSLFHETNGASKVRMTDAGKMDTNSQFQ
EIWEILGKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQQQQQQQQQQQ
QQHYGMTSKSSSPDEEKKNNKEPKRESRVSPEENGEEETGHKQFKLPKTS
TFSSGSHDSNLQSPFYNHEYRHYARSKFECKNQFRKSVSPIKEIPATTSA
NEGWNILRDIIEKLNISNVDDRNKDLLFRRDEIGDKNHSDSIDIENLSIK
EPKGMKRRKKDDISLEELFQSLPREKDYFMMDAINDSLESINLFKKPKTT
QSHEQGGTFAQAESNRAKFKPLLEQCGITPEILDLEIPEIPEFDAVADLE
TLKLNVQLFNNQCNKLKETIHQVSLQRLRADTQFSDMLTQKQSIMVWKTY
LEFDKSLMDKLNILQERQMQVIKIFSERCDGKV
Length583
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000003698
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.