YLR106C
Systematic NameYLR106C
Standard NameMDN1
SynonymREA1
Full Namemidasin
DescriptionHuge dynein-related AAA-type ATPase (midasin), forms extended pre-60S particle with the Rix1 complex (Rix1p-Ipi1p-Ipi3p), may mediate ATP-dependent remodeling of 60S subunits and subsequent export from nucleoplasm to cytoplasm
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
Molecular FunctionGO:0016887 ATPase activity
Biological ProcessGO:0000027 ribosomal large subunit assembly and maintenance
GO:0006364 rRNA processing
GO:0006461 protein complex assembly
LocalizationGranular staining.
Sequence
MSQDRILLDLDVVNQRLILFNSAFPSDAIEAPFHFSNKESTSENLDNLAG
TILHSRSITGHVFLYKHIFLEIVARWIKDSKKKDYVLVIEKLASIITIFP
VAMPLIEDYLDKENDHFITILQNPSTQKDSDMFKILLAYYRLLYHNKEVF
ARFIQPDILYQLVDLLTKEQENQVVIFLALKVLSLYLDMGEKTLNDMLDT
YIKSRDSLLGHFEGDSGIDYSFLELNEAKRCANFSKLPSVPECFTIEKKS
SYFIIEPQDLSTKVASICGVIVPKVHTIHDKVFYPLTFVPTHKTVSSLRQ
LGRKIQNSTPIMLIGKAGSGKTFLINELSKYMGCHDSIVKIHLGEQTDAK
LLIGTYTSGDKPGTFEWRAGVLATAVKEGRWVLIEDIDKAPTDVLSILLS
LLEKRELTIPSRGETVKAANGFQLISTVRINEDHQKDSSNKIYNLNMIGM
RIWNVIELEEPSEEDLTHILAQKFPILTNLIPKLIDSYKNVKSIYMNTKF
ISLNKGAHTRVVSVRDLIKLCERLDILFKNNGINKPDQLIQSSVYDSIFS
EAADCFAGAIGEFKALEPIIQAIGESLDIASSRISLFLTQHVPTLENLDD
SIKIGRAVLLKEKLNIQKKSMNSTLFAFTNHSLRLMEQISVCIQMTEPVL
LVGETGTGKTTVVQQLAKMLAKKLTVINVSQQTETGDLLGGYKPVNSKTV
AVPIQENFETLFNATFSLKKNEKFHKMLHRCFNKNQWKNVVKLWNEAYKM
AQSILKITNTENENENAKKKKRRLNTHEKKLLLDKWADFNDSVKKFEAQS
SSIENSFVFNFVEGSLVKTIRAGEWLLLDEVNLATADTLESISDLLTEPD
SRSILLSEKGDAEPIKAHPDFRIFACMNPATDVGKRDLPMGIRSRFTEIY
VHSPERDITDLLSIIDKYIGKYSVSDEWVGNDIAELYLEAKKLSDNNTIV
DGSNQKPHFSIRTLTRTLLYVTDIIHIYGLRRSLYDGFCMSFLTLLDQKS
EAILKPVIEKFTLGRLKNVKSIMSQTPPSPGPDYVQFKHYWMKKGPNTIQ
EQAHYIITPFVEKNMMNLVRATSGKRFPVLIQGPTSSGKTSMIKYLADIT
GHKFVRINNHEHTDLQEYLGTYVTDDTGKLSFKEGVLVEALRKGYWIVLD
ELNLAPTDVLEALNRLLDDNRELFIPETQEVVHPHPDFLLFATQNPPGIY
GGRKILSRAFRNRFLELHFDDIPQDELEIILRERCQIAPSYAKKIVEVYR
QLSIERSASRLFEQKNSFATLRDLFRWALRDAVGYEQLAASGYMLLAERC
RTPQEKVTVKKTLEKVMKVKLDMDQYYASLEDKSLEAIGSVTWTKGMRRL
SVLVSSCLKNKEPVLLVGETGCGKTTICQLLAQFMGRELITLNAHQNTET
GDILGAQRPVRNRSEIQYKLIKSLKTALNIANDQDVDLKELLQLYSKSDN
KNIAEDVQLEIQKLRDSLNVLFEWSDGPLIQAMRTGNFFLLDEISLADDS
VLERLNSVLEPERSLLLAEQGSSDSLVTASENFQFFATMNPGGDYGKKEL
SPALRNRFTEIWVPSMEDFNDVNMIVSSRLLEDLKDLANPIVKFSEWFGK
KLGGGNATSGVISLRDILAWVEFINKVFPKIQNKSTALIQGASMVFIDAL
GTNNTAYLAENENDLKSLRTECIIQLLKLCGDDLELQQIETNEIIVTQDE
LQVGMFKIPRFPDAQSSSFNLTAPTTASNLVRVVRAMQVHKPILLEGSPG
VGKTSLITALANITGNKLTRINLSEQTDLVDLFGADAPGERSGEFLWHDA
PFLRAMKKGEWVLLDEMNLASQSVLEGLNACLDHRGEAYIPELDISFSCH
PNFLVFAAQNPQYQGGGRKGLPKSFVNRFSVVFIDMLTSDDLLLIAKHLY
PSIEPDIIAKMIKLMSTLEDQVCKRKLWGNSGSPWEFNLRDTLRWLKLLN
QYSICEDVDVFDFVDIIVKQRFRTISDKNKAQLLIEDIFGKFSTKENFFK
LTEDYVQINNEVALRNPHYRYPITQNLFPLECNVAVYESVLKAINNNWPL
VLVGPSNSGKTETIRFLASILGPRVDVFSMNSDIDSMDILGGYEQVDLTR
QISYITEELTNIVREIISMNMKLSPNATAIMEGLNLLKYLLNNIVTPEKF
QDFRNRFNRFFSHLEGHPLLKTMSMNIEKMTEIITKEASVKFEWFDGMLV
KAVEKGHWLILDNANLCSPSVLDRLNSLLEIDGSLLINECSQEDGQPRVL
KPHPNFRLFLTMDPKYGELSRAMRNRGVEIYIDELHSRSTAFDRLTLGFE
LGENIDFVSIDDGIKKIKLNEPDMSIPLKHYVPSYLSRPCIFAQVHDILL
LSDEEPIEESLAAVIPISHLGEVGKWANNVLNCTEYSEKKIAERLYVFIT
FLTDMGVLEKINNLYKPANLKFQKALGLHDKQLTEETVSLTLNEYVLPTV
SKYSDKIKSPESLYLLSSLRLLLNSLNALKLINEKSTHGKIDELTYIELS
AAAFNGRHLKNIPRIPIFCILYNILTVMSENLKTESLFCGSNQYQYYWDL
LVIVIAALETAVTKDEARLRVYKELIDSWIASVKSKSDIEITPFLNINLE
FTDVLQLSRGHSITLLWDIFRKNYPTTSNSWLAFEKLINLSEKFDKVRLL
QFSESYNSIKDLMDVFRLLNDDVLNNKLSEFNLLLSKLEDGINELELISN
KFLNKRKHYFADEFDNLIRYTFSVDTAELIKELAPASSLATQKLTKLITN
KYNYPPIFDVLWTEKNAKLTSFTSTIFSSQFLEDVVRKSNNLKSFSGNQI
KQSISDAELLLSSTIKCSPNLLKSQMEYYKNMLLSWLRKVIDIHVGGDCL
KLTLKELCSLIEEKTASETRVTFAEYIFPALDLAESSKSLEELGEAWITF
GTGLLLLFVPDSPYDPAIHDYVLYDLFLKTKTFSQNLMKSWRNVRKVISG
DEEIFTEKLINTISDDDAPQSPRVYRTGMSIDSLFDEWMAFLSSTMSSRQ
IKELVSSYKCNSDQSDRRLEMLQQNSAHFLNRLESGYSKFADLNDILAGY
IYSINFGFDLLKLQKSKDRASFQISPLWSMDPINISCAENVLSAYHELSR
FFKKGDMEDTSIEKVLMYFLTLFKFHKRDTNLLEIFEAALYTLYSRWSVR
RFRQEQEENEKSNMFKFNDNSDDYEADFRKLFPDYEDTALVTNEKDISSP
ENLDDIYFKLADTYISVFDKDHDANFSSELKSGAIITTILSEDLKNTRIE
ELKSGSLSAVINTLDAETQSFKNTEVFGNIDFYHDFSIPEFQKAGDIIET
VLKSVLKLLKQWPEHATLKELYRVSQEFLNYPIKTPLARQLQKIEQIYTY
LAEWEKYASSEVSLNNTVKLITDLIVSWRKLELRTWKGLFNSEDAKTRKS
IGKWWFYLYESIVISNFVSEKKETAPNATLLVSSLNLFFSKSTLGEFNAR
LDLVKAFYKHIQLIGLRSSKIAGLLHNTIKFYYQFKPLIDERITNGKKSL
EKEIDDIILLASWKDVNVDALKQSSRKSHNNLYKIVRKYRDLLNGDAKTI
IEAGLLYSNENKLKLPTLKQHFYEDPNLEASKNLVKEISTWSMRAAPLRN
IDTVASNMDSYLEKISSQEFPNFADLASDFYAEAERLRKETPNVYTKENK
KRLAYLKTQKSKLLGDALKELRRIGLKVNFREDIQKVQSSTTTILANIAP
FNNEYLNSSDAFFFKILDLLPKLRSAASNPSDDIPVAAIERGMALAQSLM
FSLITVRHPLSEFTNDYCKINGMMLDLEHFTCLKGDIVHSSLKANVDNVR
LFEKWLPSLLDYAAQTLSVISKYSATSEQQKILLDAKSTLSSFFVHFNSS
RIFDSSFIESYSRFELFINELLKKLENAKETGNAFVFDIIIEWIKANKGG
PIKKEQKRGPSVEDVEQAFRRTFTSIILSFQKVIGDGIESISETDDNWLS
ASFKKVMVNVKLLRSSVVSKNIETALSLLKDFDFTTTESIYVKSVISFTL
PVITRYYNAMTVVLERSRIYYTNTSRGMYILSTILHSLAKNGFCSPQPPS
EEVDDKNLQEGTGLGDGEGAQNNNKDVEQDEDLTEDAQNENKEQQDKDER
DDENEDDAVEMEGDMAGELEDLSNGEENDDEDTDSEEEELDEEIDDLNED
DPNAIDDKMWDDKASDNSKEKDTDQNLDGKNQEEDVQAAENDEQQRDNKE
GGDEDPNAPEDGDEEIENDENAEEENDVGEQEDEVKDEEGEDLEANVPEI
ETLDLPEDMNLDSEHEESDEDVDMSDGMPDDLNKEEVGNEDEEVKQESGI
ESDNENDEPGPEEDAGETETALDEEEGAEEDVDMTNDEGKEDEENGPEEQ
AMSDEEELKQDAAMEENKEKGGEQNTEGLDGVEEKADTEDIDQEAAVQQD
SGSKGAGADATDTQEQDDVGGSGTTQNTYEEDQEDVTKNNEESREEATAA
LKQLGDSMKEYHRRRQDIKEAQTNGEEDENLEKNNERPDEFEHVEGANTE
TDTQALGSATQDQLQTIDEDMAIDDDREEQEVDQKELVEDADDEKMDIDE
EEMLSDIDAHDANNDVDSKKSGFIGKRKSEEDFENELSNEHFSADQEDDS
EIQSLIENIEDNPPDASASLTPERSLEESRELWHKSEISTADLVSRLGEQ
LRLILEPTLATKLKGDYKTGKRLNMKRIIPYIASQFRKDKIWLRRTKPSK
RQYQIMIALDDSKSMSESKCVKLAFDSLCLVSKTLTQLEAGGLSIVKFGE
NIKEVHSFDQQFSNESGARAFQWFGFQETKTDVKKLVAESTKIFERARAM
VHNDQWQLEIVISDGICEDHETIQKLVRRARENKIMLVFVIIDGITSNES
ILDMSQVNYIPDQYGNPQLKITKYLDTFPFEFYVVVHDISELPEMLSLIL
RQYFTDLASS
Length4910
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000004096
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.