YPL038W
Systematic NameYPL038W
Standard NameMET31
Full Namehighly homologous to Met32p, transcriptional regulator of sulfur amino acid metabolism, zinc finger protein
DescriptionZinc-finger DNA-binding protein, involved in regulating expression of the methionine biosynthetic genes, similar to Met32p
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
GO:0005737 cytoplasm
Molecular FunctionGO:0003677 DNA binding
GO:0003704 specific RNA polymerase II transcription factor activity
Biological ProcessGO:0000096 sulfur amino acid metabolism
GO:0045449 regulation of transcription
LocalizationGranular staining.
Sequence
MKLAQDMNVDEIFLKQAAEAIAVISSSPTHTDPIIRELLHRIRQSSPLSA
VIPAPENVLKAGEPENMARGLIRIPETQTKRTGGNNHSKEGAQLYSCAKC
QLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHSNTLTCQRN
RKKLSEGSDVDVDELIKDAIKNGTGLL
Length177
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000005959
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.