YML062C
Systematic NameYML062C
Standard NameMFT1
SynonymMFT52
Full Namemitochondrial targeting protein
DescriptionSubunit of the THO complex, which is a nuclear complex comprised of Hpr1p, Mft1p, Rlr1p, and Thp2p, that is involved in transcription elongation and mitotic recombination; involved in telomere maintenance
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0000347 THO complex
Molecular FunctionGO:0003676 nucleic acid binding
Biological ProcessGO:0000723 telomere maintenance
GO:0006310 DNA recombination
GO:0006368 RNA elongation from RNA polymerase II promoter
GO:0006406 mRNA export from nucleus
Localizationsome staining of the nucleus also
Sequence
MPLSQKQIDQVRTKVHYSEVDTPFNKYLDILGKVTKLTGSIINGTLSNDD
SKIEKLTEQNISQLKESAHLRFLDLQSSIDTKKVADENWETCQQETLAKL
ENLKDKLPDIKSIHSKLLLRIGKLQGLYDSVQVINREVEGLSEGRTSLVV
TRAEWEKELGTDLVKFLIEKNYLKLVDPGLKKDSSEERYRIYDDFSKGPK
ELESINASMKSDIENVRQEVSSYKEKWLRDAEIFGKITSIFKEELLKRDG
LLNEAEGDNIDEDYESDEDEERKERFKRQRSMVEVNTIENVDEKEESDHE
YDDQEDEENEEEDDMEVDVEDIKEDNEVDGESSQQEDNSRQGNNEETDKE
TGVIEEPDAVNDAEEADSDHSSRKLGGTTSDFSASSSVEEVK
Length392
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000004527
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.