YMR177W
Systematic NameYMR177W
Standard NameMMT1
Full Namemitochondrial metal transporter (putative)
DescriptionPutative metal transporter involved in mitochondrial iron accumulation; closely related to Mmt2p
CommentNull mutant is viable, mmt1 mmt2 double deletion mutants exhibit a growth defect on low iron medium
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005739 mitochondrion
GO:0016021 integral to membrane
Molecular FunctionGO:0005554 molecular function unknown
Biological ProcessGO:0006879 iron ion homeostasis
Sequence
MLRICVKRPCIKIVLSQVRPALLVRKENLHISTGVKVEKSSIINQKDPNK
VRVEINELKRQAEIEKAAIKELEKNPQYQKLAEAFNSHDHVHLRESETEQ
NDIISLGTIRDYKSSKCEQADKPSSLNLHSHTHSHGHTHSHAAHNPLLVL
STEQIRKNAGVRITWVGLGVNVGIAIGKFFGGIVFHSQALFADAIHAISD
MVSDLLTLLSVGLAANKPTADYPYGYGKIETVGSLAVSTILAMAGISIGW
SSLCALVGPVIPHTIIDTIGNLGHAHTYSEDIIEDVTDINAAWIAAASIA
AKEWIFRATRKIAINTNSNVLMANAWHHRVDSLTSLVALVAISTGYLVNI
QSLDTIGGLIVSGLIIKAGGEGMCIAIKELIDQSVSRDDPRYLEIETLVK
DTLNKLISNNNSQKPYGLKELTLLSSGPNLRGHLTLEVPLQKWGNILGVN
EFEIVTHHLRNVLTNEVSNLRRLDIEYVEEKNGEENEHIKGQQNYKEDVL
IKHDHTNTHI
Length510
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000004789
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.