YER042W
Systematic NameYER042W
Standard NameMXR1
SynonymMSRA
Full Namepeptide methionine sulfoxide reductase
DescriptionPeptide methionine sulfoxide reductase, reverses the oxidation of methionine residues; involved in oxidative damage repair, providing resistance to oxidative stress and regulation of lifespan
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
GO:0005737 cytoplasm
Molecular FunctionGO:0008113 protein-methionine-S-oxide reductase activity
Biological ProcessGO:0006979 response to oxidative stress
Sequence
MSSLISKTIKYDPAKDKLITLACGCFWGTEHMYRKYLNDRIVDCKVGYAN
GEESKKDSPSSVSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRIH
DPTTSNSQGPDKGTQYRSGLFAHSDADLKELAKIKEEWQPKWGNKIATVI
EPIKNFYDAEEYHQLYLDKNPQGYACPTHYLREM
Length184
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000844
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.