YKL057C
Systematic NameYKL057C
Standard NameNUP120
SynonymRAT2
Full Name100 kDa protein (predicted molecular weight is 120 kDa) with two leucine zipper motifs, coiled-coil region, and some homology to Nup133p, nuclear pore complex subunit
DescriptionSubunit of the Nup84p subcomplex of the nuclear pore complex (NPC), required for even distribution of NPCs around the nuclear envelope, involved in establishment of a normal nucleocytoplasmic concentration gradient of the GTPase Gsp1p
CommentNull mutant is viable but grows slower, is temperature-sensitive, and shows nucleolar fragmentation and clustering of nuclear pore complexes; at nonpermissive temperature, null mutant accumulates poly(A)+ mRNA in nucleus and shows nucleolar fragmentation and spindle defects; temperature sensitivity can be suppressed by growth in high osmolarity media; synthetically lethal with nup133 and nup159
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005643 nuclear pore
Molecular FunctionGO:0005198 structural molecule activity
Biological ProcessGO:0006259 DNA metabolism
GO:0006406 mRNA export from nucleus
GO:0006407 rRNA export from nucleus
GO:0006408 snRNA export from nucleus
GO:0006409 tRNA export from nucleus
GO:0006607 NLS-bearing substrate import into nucleus
GO:0006608 snRNP protein import into nucleus
GO:0006609 mRNA-binding (hnRNP) protein import into nucleus
GO:0006610 ribosomal protein import into nucleus
GO:0006611 protein export from nucleus
GO:0006999 nuclear pore organization and biogenesis
GO:0050000 chromosome localization
Localizationgranular staining;
Sequence
MACLSRIDANLLQYYEKPEPNNTVDLYVSNNSNNNGLKEGDKSISTPVPQ
PYGSEYSNCLLLSNSEYICYHFSSRSTLLTFYPLSDAYHGKTINIHLPNA
SMNQRYTLTIQEVEQQLLVNVILKDGSFLTLQLPLSFLFSSANTLNGEWF
HLQNPYDFTVRVPHFLFYVSPQFSVVFLEDGGLLGLKKVDGVHYEPLLFN
DNSYLKSLTRFFSRSSKSDYDSVISCKLFHERYLIVLTQNCHLKIWDLTS
FTLIQDYDMVSQSDSDPSHFRKVEAVGEYLSLYNNTLVTLLPLENGLFQM
GTLLVDSSGILTYTFQNNIPTNLSASAIWSIVDLVLTRPLELNVEASYLN
LIVLWKSGTASKLQILNVNDESFKNYEWIESVNKSLVDLQSEHDLDIVTK
TGDVERGFCNLKSRYGTQIFERAQQILSENKIIMAHNEDEEYLANLETIL
RDVKTAFNEASSITLYGDEIILVNCFQPYNHSLYKLNTTVENWFYNMHSE
TDGSELFKYLRTLNGFASTLSNDVLRSISKKFLDIITGELPDSMTTVEKF
TDIFKNCLENQFEITNLKILFDELNSFDIPVVLNDLINNQMKPGIFWKKD
FISAIKFDGFTSIISLESLHQLLSIHYRITLQVLLTFVLFDLDTEIFGQH
ISTLLDLHYKQFLLLNLYRQDKCLLAEVLLKDSSEFSFGVKFFNYGQLIA
YIDSLNSNVYNASITENSFFMTFFRSYIIENTSHKNIRFFLENVECPFYL
RHNEVQEFMFAMTLFSCGNFDQSYEIFQLHDYPEAINDKLPTFLEDLKSE
NYHGDSIWKDLLCTFTVPYRHSAFYYQLSLLFDRNNSQEFALKCISKSAE
YSLKEIQIEELQDFKEKQHIHYLNLLIHFRMFEEVLDVLRLGHECLSDTV
RTNFLQLLLQEDIYSRDFFSTLLRLCNAHSDNGELYLRTVDIKIVDSILS
QNLRSGDWECFKKLYCFRMLNKSERAAAEVLYQYILMQADLDVIRKRKCY
LMVINVLSSFDSAYDQWILNGSKVVTLTDLRDELRGL
Length1037
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000001540
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.