YBL079W
Systematic NameYBL079W
Standard NameNUP170
SynonymNLE3
Full Namenuclear pore complex subunit
DescriptionAbundant subunit of the nuclear pore complex (NPC), required for proper localization of specific nucleoporins within the NPC, involved in nuclear envelope permeability and in chromosome segregation, has similarity to Nup157p
CommentNull mutant is viable; synthetically lethal with nup157, nup188, and pom152; changing NUP170 expression causes morphological abnormalities in nuclear envelope
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005643 nuclear pore
Molecular FunctionGO:0005198 structural molecule activity
Biological ProcessGO:0000059 protein import into nucleus, docking
GO:0006406 mRNA export from nucleus
GO:0006407 rRNA export from nucleus
GO:0006408 snRNA export from nucleus
GO:0006409 tRNA export from nucleus
GO:0006607 NLS-bearing substrate import into nucleus
GO:0006608 snRNP protein import into nucleus
GO:0006609 mRNA-binding (hnRNP) protein import into nucleus
GO:0006610 ribosomal protein import into nucleus
GO:0006611 protein export from nucleus
GO:0006999 nuclear pore organization and biogenesis
GO:0007059 chromosome segregation
Localizationgranular staining;
Sequence
MFQSFFHNNGPAAAGETFSDSRSYPLTNHQEVPRNGLNELASSATKAQQQ
PTHILNSYPITGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKP
LDLAGKYIDHLQHKDSNTPVLDERSYYNSGVDYNFSREKNGLGAFTPFEK
QDVFNIPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNE
YQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKA
TNELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSG
SDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGG
FSQETITQLTIDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISR
IIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGGVRLYFNG
SMGRFNIEALRLESIKFPPSSVTPEVIQQELLHQQQEQAKRSFPFFSNLM
SSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQQTHQQEKKEN
SSVTGTTATAGSKTVKQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLE
TAGPVQQIIPLSGLFNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIY
KYRTPDEIFEDLIDNPLPFVLNYGAAEACSTALFVTCKSNKSEKLRSNAL
TFLTMGIPGVVDIKPVYNRYSVSTVSSLLSKPTLSTATTNLQQSITGFSK
PSPANKEDFDLDDVILSPRFYGIALLITRLLRDIWGRHVFMTFTDNRVTS
HAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIEYYLSSINILN
EFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMV
QSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFK
DLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASD
ILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEA
VSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDK
RILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAAL
KYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNIL
WVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCNSVSPLS
QKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGK
ILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRME
FNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYE
TLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTW
LIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFY
KE
Length1502
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000175
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.