YCR024C-A
Systematic NameYCR024C-A
Standard NamePMP1
Full Nameproteolipid associated with plasma membrane H(+)-ATPase (Pma1p)
DescriptionSmall single-membrane span proteolipid that functions as a regulatory subunit of the plasma membrane H(+)-ATPase Pma1p, forms unique helix and positively charged cytoplasmic domain that is able to specifically segregate phosphatidylserines
CommentNull mutant is viable; pmp1 pmp2 double mutant displays a lower Vmax for the plasma membrane H(+)-ATPase (Pma1p)
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005886 plasma membrane
GO:0016020 membrane
Molecular FunctionGO:0030234 enzyme regulator activity
Biological ProcessGO:0006812 cation transport
Localizationpatchy staining somewhat concentrated around the cell periphery
Sequence
MTLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF
Length40
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000619
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.