YNL290W
Systematic NameYNL290W
Standard NameRFC3
Full Namereplication factor C subunit 3, similar to human RFC 36 kDa subunit
DescriptionSubunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
GO:0005663 DNA replication factor C complex
Molecular FunctionGO:0003689 DNA clamp loader activity (contributes to)
GO:0016887 ATPase activity
Biological ProcessGO:0006272 leading strand elongation
GO:0006298 mismatch repair
GO:0007062 sister chromatid cohesion
Sequence
MSTSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLL
FYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDF
ASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYA
HKLTPALLSRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIEL
SNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKS
ILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLL
TKLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANV
Length340
Image
 
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000005234
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.