|
| YBR084C-A | |||||||
| Systematic Name | YBR084C-A | ||||||
| Standard Name | RPL19A | ||||||
| Full Name | ribosomal protein L19A (L23A) (rpl5L) (YL14) | ||||||
| Description | Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal | ||||||
| Comment | Null mutant is viable but grows slowly. | ||||||
| Organism | |||||||
| Common Name | baker's yeast | ||||||
| Scientific Name | Saccharomyces cerevisiae | ||||||
| Gene Ontology (GO) | |||||||
| Cellular Component | GO:0005842 cytosolic large ribosomal subunit (sensu Eukaryota) | ||||||
| Molecular Function | GO:0003735 structural constituent of ribosome | ||||||
| Biological Process | GO:0006412 protein biosynthesis | ||||||
| Localization | granular staining | ||||||
| Sequence | |||||||
| MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTI VKKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLR VLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQ REKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA | |||||||
| Length | 189 | ||||||
| Image | |||||||
 | |||||||
| Visualization | |||||||
| Organelle View | View this protein's localizations in 3D| Data Source | | SGD:S000002156 | | Anuj Kumar's lab / Mike Snyder's lab | | |