YBL027W
Systematic NameYBL027W
Standard NameRPL19B
Full Nameribosomal protein L19B (YL14) (L23B) (rpl5L)
DescriptionProtein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Ap and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal
CommentNull mutant is viable but grows slowly.
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005842 cytosolic large ribosomal subunit (sensu Eukaryota)
Molecular FunctionGO:0003735 structural constituent of ribosome
Biological ProcessGO:0006412 protein biosynthesis
Localizationgranular staining; staining of the nuclear rim/ER as well
Sequence
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTI
VKKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLR
VLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQ
REKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA
Length189
Image
 
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000123
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.