YBR024W
Systematic NameYBR024W
Standard NameSCO2
DescriptionProtein anchored to the mitochondrial inner membrane, similar to Sco1p and may have a redundant function with Sco1p in delivery of copper to cytochrome c oxidase; interacts with Cox2p
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005740 mitochondrial envelope
Molecular FunctionGO:0008379 thioredoxin peroxidase activity
Biological ProcessGO:0006825 copper ion transport
Localizationgranular staining
Sequence
MLNSSRKYACRSLFRQANVSIKGLFYNGGAYRRGFSTGCCLRSDNKESPS
ARQPLDRLQLGDEINEPEPIRTRFFQFSRWKATIALLLLSGGTYAYLSRK
RRLLETEKEADANRAYGSVALGGPFNLTDFNGKPFTEENLKGKFSILYFG
FSHCPDICPEELDRLTYWISELDDKDHIKIQPLFISCDPARDTPDVLKEY
LSDFHPAIIGLTGTYDQVKSVCKKYKVYFSTPRDVKPNQDYLVDHSIFFY
LIDPEGQFIDALGRNYDEQSGLEKIREQIQAYVPKEERERRSKKWYSFIF
N
Length301
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000000228
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.