YPR161C
Systematic NameYPR161C
Standard NameSGV1
SynonymBUR1
Full NameCDC28/cdc2 related protein kinase
DescriptionCyclin (Bur2p)-dependent protein kinase that functions in transcriptional regulation; phosphorylates the carboxy-terminal domain of Rpo21p, which is the largest subunit of RNA polymerase II; regulated by Cak1p
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
Molecular FunctionGO:0004693 cyclin-dependent protein kinase activity
Biological ProcessGO:0006350 transcription
GO:0006468 protein amino acid phosphorylation
Localizationgranular staining;
Sequence
MSDNGSPAVLPKTEFNKYKIGKVKSTPAIQRDAKTNLTYIKLRKRSSEKV
YGCTVFQNHYREDEKLGQGTFGEVYKGIHLETQRQVAMKKIIVSVEKDLF
PITAQREITILKRLNHKNIIKLIEMVYDHSPDITNAASSNLHKSFYMILP
YMVADLSGVLHNPRINLEMCDIKNMMLQILEGLNYIHCAKFMHRDIKTAN
ILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSGAKYTSVVVTRWYRA
PELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLG
TPTEEDWAVARYLPGAELTTTNYKPTLRERFGKYLSETGLDFLGQLLALD
PYKRLTAMSAKHHPWFKEDPLPSEKITLPTEESHEADIKRYKEEMHQSLS
QRVPTAPRGHIVEKGESPVVKNLGAIPRGPKKDDASFLPPSKNVLAKPPP
SKIRELHQNPRPYHVNSGYAKTAIPPPAAPAGVNRYGPNNSSRNNRFSGN
STAPNNSRNPVNRFHPETNVSSKYNKVPLPLGPQSRYQGNSNESRYKNSP
NDSRYHNPRYVNKPETNFNRQPQKYSRQESNAPINKNYNPSNGSRNMAGD
HHQGSRPSHPQFPISPSQGQHQLTSKPIEKKNGSFKDERAKPDESKEFQN
SDIADLY
Length657
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000006365


Kumar Lab
MCDB
The University of Michigan.