YIL144W
Systematic NameYIL144W
Standard NameTID3
SynonymHEC1
NDC80
DescriptionComponent of the evolutionarily conserved kinetochore-associated Ndc80 complex (Ndc80p-Nuf2p-Spc24p-Spc25p); conserved coiled-coil protein involved in chromosome segregation, spindle checkpoint activity, kinetochore assembly and clustering
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0000778 condensed nuclear chromosome kinetochore
GO:0000780 condensed nuclear chromosome, pericentric region
GO:0031262 Ndc80 complex
Molecular FunctionGO:0005200 structural constituent of cytoskeleton
Biological ProcessGO:0007020 microtubule nucleation
GO:0007059 chromosome segregation
Localizationsome cytoplasmic staining also
Sequence
MQSSTSTDQHVLHHMDPHRFTSQIPTATSSQLRRRNSTNQGLTDMINKSI
ARNTISGTGIPTGGINKNKRTRSTVAGGTNGTALALNDKSNSRNSVSRLS
INQLGSLQQHLSNRDPRPLRDKNFQSAIQEEIYDYLKKNKFDIETNHPIS
IKFLKQPTQKGFIIIFKWLYLRLDPGYGFTKSIENEIYQILKNLRYPFLE
SINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQE
ITILSQPLKTLDEQDQRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPS
MQELKLGFEKFVHIINTDIANLQTQNDNLYEKYQEVMKISQKIKTTREKW
KALKSDSNKYENYVNAMKQKSQEWPGKLEKMKSECELKEEEIKALQSNIS
ELHKILRKKGISTEQFELQNQEREKLTRELDKINIQSDKLTSSIKSRKLE
AEGIFKSLLDTLRQYDSSIQNLTRSRSQLGHNVNDSSLKINISENLLDRD
FHEGISYEQLFPKGSGINESIKKSILKLNDEIQERIKTIEKDNITLEKDI
KNLKHDINEKTQINEKLELELSEANSKFELSKQENERLLVAQRIEIEKME
KKINDSNLLMKTKISDAEELVTSTELKLEELKVDLNRKRYKLHQQVIHVI
DITSKFKINIQSSLENSENELGNVIEELRNLEFETEHNVTN
Length691
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000001406
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.