YDL201W
Systematic NameYDL201W
Standard NameTRM8
DescriptionSubunit of a tRNA methyltransferase complex composed of Trm8p and Trm82p that catalyzes 7-methylguanosine modification of tRNA
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
Molecular FunctionGO:0005515 protein binding
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity (contributes to)
Biological ProcessGO:0030488 tRNA methylation
Sequence
MKAKPLSQDPGSKRYAYRINKEENRKELKHVKINESSLVQEGQKIDLPKK
RYYRQRAHSNPFSDHQLEYPVSPQDMDWSKLYPYYKNAENGQMTKKVTIA
DIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTASKH
GFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHFKQRKHKARIITNT
LLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDE
CVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL
Length286
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000002360
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.