YHR012W
Systematic NameYHR012W
Standard NameVPS29
SynonymPEP11
DescriptionEndosomal protein that is a subunit of the membrane-associated retromer complex essential for endosome-to-Golgi retrograde transport; forms a subcomplex with Vps35p and Vps26p that selects cargo proteins for endosome-to-Golgi retrieval
CommentDefective for sorting of soluble hydrolases to the vacuole. Mislocalisation of the vacuolar hydrolase sorting receptor Vps10p.
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005768 endosome
GO:0030904 retromer complex
Molecular FunctionGO:0005554 molecular function unknown
GO:0008565 protein transporter activity (contributes to)
Biological ProcessGO:0042147 retrograde transport, endosome to Golgi
Localizationgranular staining; staining of the nuclear rim
Sequence
MLLLALSDAHIPDRATDLPVKFKKLLSVPDKISQVALLGNSTKSYDFLKF
VNQISNNITIVRGEFDNGHLPSTKKDKASDNSRPMEEIPMNSIIRQGALK
IGCCSGYTVVPKNDPLSLLALARQLDVDILLWGGTHNVEAYTLEGKFFVN
PGSCTGAFNTDWPIVFDVEDSDEAVTSEVDKPTKENQSEDDDAKGGSTGK
EQPGSYTPKEGTAGERENENESNVKPENQFKEDEVDMSDSDINGSNSPSF
CLLDIQGNTCTLYIYLYVNGEVKVDKVVYEKE
Length282
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000001054
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.