YFL004W
Systematic NameYFL004W
Standard NameVTC2
SynonymPHM1
Full Namepolyphosphate synthetase (putative)
DescriptionVacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in protein localization and non-autophagic vacuolar fusion
CommentNull nutant is viable; no polyphosphate accumulation in a vtc2(phm1)/vtc3(phm2) double disruptant
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005774 vacuolar membrane
Molecular FunctionGO:0005554 molecular function unknown
Biological ProcessGO:0008104 protein localization
GO:0042144 vacuole fusion, non-autophagic
Localizationgranular staining; granules cluster
Sequence
MLFGVKLANEVYPPWKGSYINYEGLKKFLKEDSVKDGSNDKKARWDDSDE
SKFVEELDKELEKVYGFQLKKYNNLMERLSHLEKQTDTEAAIKALDADAF
QRVLEELLSESTELDNFKRLNFTGFAKIVKKHDKLYPKYPSVKSLLEVRL
KELPSHSEEYSPLLYRISFLYNILRSNFNTASEPLASASKFSSIVSNDID
MNFRSFKFWVHNDNLMEVKTRILRHLPVLVYANVPSENDDLVNRFESDIS
NNDEIVGSSSSTSSVEHGLGARSFDPLINTLYFDNEHFELYNDKLLKLNS
APTLRLRWTGQLSDKPDIFLEKKTLIEDEATGKSEFDLTKLQLKQKFING
FIFEGDKKFKEQTLKKLKESGTAGRDLERLEEDFSEIQNFIIKNELQPVF
RTVYTRTAFQIPGDDKIRVTIDSNIVFIKEDSFDRERPIRDPNTWHRTDI
DANVANPLKFLRGGEYAKFPYSVMEIKVKSSLDSSMSASSMISNVKLPKK
HGQWLNDLTNSHLVKEIPKFSIFVQGVASLYGDDEKLDILPFWLPDLETD
IRQDPKQAYEEEKKKLLKQKEIQKKIDGMRRLSNLKEPQHQAAVPVSQEE
NERITSQGDLEADGSSDEETEQEPHSKRSKKVRRRKPKATFLRILAGRDP
KLMGVDSEEEEIELPPGVKKPLNLLKNAGPVNVEAKVWLANERTFNRWLS
VTSLLSVLTFSIYNSVKKAEYPTLANYMAYVYFGLTIFCALWSYSIYMKR
VDIIQQRSGQHLDAPLGPVLVSIVLFVTLVVNFVMAFRNAAKSRQELQIQ
NLEVPERIPEVLRPLQNYLFKLMGPSSD
Length828
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000001890


Kumar Lab
MCDB
The University of Michigan.