YMR104C
Systematic NameYMR104C
Standard NameYPK2
SynonymYKR2
Full Nameprotein kinase
DescriptionProtein kinase with similarityto serine/threonine protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; homolog of mammalian kinase SGK
Organism
Common Namebaker's yeast
Scientific NameSaccharomyces cerevisiae
Gene Ontology (GO)
Cellular ComponentGO:0005634 nucleus
GO:0005737 cytoplasm
Molecular FunctionGO:0004672 protein kinase activity
Biological ProcessGO:0006468 protein amino acid phosphorylation
LocalizationGranular staining. * Granular staining
Sequence
MHSWRISKFKLGRSKEDDGSSEDENEKSWGNGLFHFHHGEKHHDGSPKNH
NHEHEHHIRKINTNETLPSSLSSPKLRNDASFKNPSGIGNDNSKASERKA
SQSSTETQGPSSESGLMTVKVYSGKDFTLPFPITSNSTILQKLLSSGILT
SSSNDASEVAAIMRQLPRYKRVDQDSAGEGLIDRAFATKFIPSSILLPGS
TNSSPLLYFTIEFDNSITTISPDMGTMEQPVFNKISTFDVTRKLRFLKID
VFARIPSLLLPSKNWQQEIGEQDEVLKEILKKINTNQDIHLDSFHLPLNL
KIDSAAQIRLYNHHWISLERGYGKLNITVDYKPSKNKPLSIDDFDLLKVI
GKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVD
CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAE
LLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTD
TFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVM
YKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGVNGTDEIRNHPFFK
DISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSAS
IQKQFGGWTYIGDEQLGDSPSQGRSIS
Length677
Image
 
Visualization
Organelle ViewView this protein's localizations in 3D
Data Source
 SGD:S000004710
 Anuj Kumar's lab / Mike Snyder's lab


Kumar Lab
MCDB
The University of Michigan.